SCOPe 2.07: Domain d5vzxl2: 5vzx L:108-213

Lineage for d5vzxl2 (5vzx L:108-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5vzxl2: 5vzx L:108-213 [337603]
   Other proteins in same PDB: d5vzxi1, d5vzxl1
   automated match to d1t66c2
   complexed with epe, mes, so4

Details for d5vzxl2

PDB Entry: 5vzx, 2.5 Å

PDB Description: crystal structure of crenezumab fab

PDB Compounds: (L:) Crenezumab Fab light chain

SCOPe Domain Sequences for d5vzxl2:

Sequence; same for both SEQRES and ATOM records:

>d5vzxl2 b.1.1.0 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5vzxl2:

• d5vzxl2 first appeared in SCOPe 2.06
  
• d5vzxl2 appears in the current release, SCOPe 2.08