Lineage for d5vzxl1 (5vzx L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743266Domain d5vzxl1: 5vzx L:1-107 [337602]
    Other proteins in same PDB: d5vzxi2, d5vzxl2
    automated match to d1t66c1
    complexed with epe, mes, so4

Details for d5vzxl1

PDB Entry: 5vzx (more details), 2.5 Å

PDB Description: crystal structure of crenezumab fab
PDB Compounds: (L:) Crenezumab Fab light chain

SCOPe Domain Sequences for d5vzxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vzxl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveik

SCOPe Domain Coordinates for d5vzxl1:

Click to download the PDB-style file with coordinates for d5vzxl1.
(The format of our PDB-style files is described here.)

Timeline for d5vzxl1: