SCOPe 2.08: Domain d5mz8b_: 5mz8 B:

Lineage for d5mz8b_ (5mz8 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (61 species)
   not a true protein

7. Species Physcomitrella patens [TaxId:3218] [337517] (3 PDB entries)

8. Domain d5mz8b_: 5mz8 B: [337600]
   automated match to d1wnda_
   complexed with edo, gol, peg, sin

Details for d5mz8b_

PDB Entry: 5mz8, 2.2 Å

PDB Description: crystal structure of aldehyde dehydrogenase 21 (aldh21) from physcomitrella patens in complex with the reaction product succinate

PDB Compounds: (B:) aldehyde dehydrogenase 21

SCOPe Domain Sequences for d5mz8b_:

Sequence; same for both SEQRES and ATOM records:

>d5mz8b_ c.82.1.0 (B:) automated matches {Physcomitrella patens [TaxId: 3218]}
tpkkyniflaskpvdgdrkwldvtnkytndvaakvpqathkdiddaidaavaaapamaam
gayerkavlekvvaelknrfeeiaqtltmesgkpikdargevtrtidtfqvaaeesvriy
gehipldisarnkglqgivkkfpigpvsmvspwnfplnlvahkvapaiavgcpfvlkpas
rtplsalilgeilhkieelplgafsilpvsredadmftvderfklltftgsgpigwdmka
ragkkkvvmelggnapcivddyvpdldytiqrlinggfyqggqscihmqrlyvherlyde
vkegfvaavkklkmgnpfeedtylgpmisesaakgiedwvkeavakggklltggnrkgaf
ieptviedvpieanarkeeifgpvvllykysdfkeavkecnnthyglqsgiftkdlnkaf
yafehmevggvilndspalrvdsqpygglkdsgiqregvkyamddmletkvlvmrnvgtl

Timeline for d5mz8b_:

• d5mz8b_ first appeared in SCOPe 2.06
  
• d5mz8b_ appears in SCOPe 2.07