Lineage for d1ulb__ (1ulb -)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488901Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 488917Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 488918Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 488997Protein Purine nucleoside phosphorylase, PNP [53169] (7 species)
  7. 489096Species Human (Homo sapiens) [TaxId:9606] [53170] (8 PDB entries)
  8. 489103Domain d1ulb__: 1ulb - [33760]

Details for d1ulb__

PDB Entry: 1ulb (more details), 2.75 Å

PDB Description: application of crystallographic and modeling methods in the design of purine nucleoside phosphorylase inhibitors

SCOP Domain Sequences for d1ulb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulb__ c.56.2.1 (-) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens)}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas

SCOP Domain Coordinates for d1ulb__:

Click to download the PDB-style file with coordinates for d1ulb__.
(The format of our PDB-style files is described here.)

Timeline for d1ulb__: