SCOP 1.67: Domain d1ulb__: 1ulb -

Lineage for d1ulb__ (1ulb -)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53170] (7 PDB entries)

8. Domain d1ulb__: 1ulb - [33760]
   complexed with gun, so4

Details for d1ulb__

PDB Entry: 1ulb, 2.75 Å

PDB Description: application of crystallographic and modeling methods in the design of purine nucleoside phosphorylase inhibitors

SCOP Domain Sequences for d1ulb__:

Sequence; same for both SEQRES and ATOM records:

>d1ulb__ c.56.2.1 (-) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens)}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas

Timeline for d1ulb__:

• d1ulb__ first appeared (with stable ids) in SCOP 1.55
  
• d1ulb__ appears in SCOP 1.65
  
• d1ulb__ appears in SCOP 1.69
  
• d1ulb__ appears in the current release, SCOPe 2.08, called d1ulba_