Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries) |
Domain d5ub5b_: 5ub5 B: [337596] automated match to d1f7ea_ complexed with ca, nag, udp; mutant |
PDB Entry: 5ub5 (more details), 2.09 Å
SCOPe Domain Sequences for d5ub5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ub5b_ g.3.11.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvnecvtnpcqndatcldqigefqcicmpgyegvhcevnt
Timeline for d5ub5b_: