Lineage for d5ub5b_ (5ub5 B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2583282Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2583283Protein automated matches [226968] (4 species)
    not a true protein
  7. 2583284Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)
  8. 2583305Domain d5ub5b_: 5ub5 B: [337596]
    automated match to d1f7ea_
    complexed with ca, nag, udp; mutant

Details for d5ub5b_

PDB Entry: 5ub5 (more details), 2.09 Å

PDB Description: human poglut1 in complex with human notch1 egf12 s458t mutant and udp
PDB Compounds: (B:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d5ub5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ub5b_ g.3.11.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvnecvtnpcqndatcldqigefqcicmpgyegvhcevnt

SCOPe Domain Coordinates for d5ub5b_:

Click to download the PDB-style file with coordinates for d5ub5b_.
(The format of our PDB-style files is described here.)

Timeline for d5ub5b_: