Lineage for d5tbpc_ (5tbp C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729439Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. 2729487Domain d5tbpc_: 5tbp C: [337590]
    automated match to d1xvpc_
    complexed with 7a4, act, dms, gol

Details for d5tbpc_

PDB Entry: 5tbp (more details), 2.6 Å

PDB Description: crystal structure of rxr-alpha ligand binding domain complexed with synthetic modulator k8003
PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d5tbpc_:

Sequence, based on SEQRES records: (download)

>d5tbpc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
edmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakrip
hfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifd
rvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhk
ypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d5tbpc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
edmpverileaelavpndpvtnicqaadkqlftlvewakriphfselplddqvillragw
nelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkt
elgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpal
rsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d5tbpc_:

Click to download the PDB-style file with coordinates for d5tbpc_.
(The format of our PDB-style files is described here.)

Timeline for d5tbpc_: