SCOPe 2.08: Domain d5tbpc_: 5tbp C:

Lineage for d5tbpc_ (5tbp C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
   Uniprot P19793 227-458

8. Domain d5tbpc_: 5tbp C: [337590]
   automated match to d1xvpc_
   complexed with 7a4, act, dms, gol

Details for d5tbpc_

PDB Entry: 5tbp, 2.6 Å

PDB Description: crystal structure of rxr-alpha ligand binding domain complexed with synthetic modulator k8003

PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d5tbpc_:

Sequence, based on SEQRES records:

>d5tbpc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
edmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakrip
hfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifd
rvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhk
ypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records):

>d5tbpc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
edmpverileaelavpndpvtnicqaadkqlftlvewakriphfselplddqvillragw
nelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkt
elgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpal
rsiglkclehlfffkligdtpidtflmemleap

Timeline for d5tbpc_:

• d5tbpc_ first appeared in SCOPe 2.06
  
• d5tbpc_ appears in SCOPe 2.07