Lineage for d1cfzf_ (1cfz F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887811Superfamily c.56.1: HybD-like [53163] (2 families) (S)
    the HybD fold coincides with the consensus core structure
  5. 2887812Family c.56.1.1: Hydrogenase maturating endopeptidase HybD [53164] (1 protein)
    automatically mapped to Pfam PF01750
  6. 2887813Protein Hydrogenase maturating endopeptidase HybD [53165] (1 species)
  7. 2887814Species Escherichia coli [TaxId:562] [53166] (2 PDB entries)
  8. 2887820Domain d1cfzf_: 1cfz F: [33759]
    complexed with cd

Details for d1cfzf_

PDB Entry: 1cfz (more details), 2.2 Å

PDB Description: hydrogenase maturating endopeptidase hybd from e. coli
PDB Compounds: (F:) hydrogenase 2 maturation protease

SCOPe Domain Sequences for d1cfzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfzf_ c.56.1.1 (F:) Hydrogenase maturating endopeptidase HybD {Escherichia coli [TaxId: 562]}
mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
peslephigltptveamiepaleqvlaalresgveaiprsds

SCOPe Domain Coordinates for d1cfzf_:

Click to download the PDB-style file with coordinates for d1cfzf_.
(The format of our PDB-style files is described here.)

Timeline for d1cfzf_: