Lineage for d1cfzc_ (1cfz C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25480Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 25481Superfamily c.56.1: Hydrogenase maturating endopeptidase HybD [53163] (1 family) (S)
  5. 25482Family c.56.1.1: Hydrogenase maturating endopeptidase HybD [53164] (1 protein)
  6. 25483Protein Hydrogenase maturating endopeptidase HybD [53165] (1 species)
  7. 25484Species Escherichia coli [TaxId:562] [53166] (1 PDB entry)
  8. 25487Domain d1cfzc_: 1cfz C: [33756]

Details for d1cfzc_

PDB Entry: 1cfz (more details), 2.2 Å

PDB Description: hydrogenase maturating endopeptidase hybd from e. coli

SCOP Domain Sequences for d1cfzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfzc_ c.56.1.1 (C:) Hydrogenase maturating endopeptidase HybD {Escherichia coli}
mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
peslephigltptveamiepaleqvlaalresgveaiprsds

SCOP Domain Coordinates for d1cfzc_:

Click to download the PDB-style file with coordinates for d1cfzc_.
(The format of our PDB-style files is described here.)

Timeline for d1cfzc_: