Lineage for d5n5sa_ (5n5s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909573Species Physcomitrella patens [TaxId:3218] [337517] (3 PDB entries)
  8. 2909582Domain d5n5sa_: 5n5s A: [337551]
    automated match to d1wnda_
    complexed with edo, nap

Details for d5n5sa_

PDB Entry: 5n5s (more details), 2.3 Å

PDB Description: crystal structure of aldehyde dehydrogenase 21 (aldh21) from physcomitrella patens in complex with nadp+
PDB Compounds: (A:) Aldehyde dehydrogenase 21 (ALDH21)

SCOPe Domain Sequences for d5n5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n5sa_ c.82.1.0 (A:) automated matches {Physcomitrella patens [TaxId: 3218]}
tpkkyniflaskpvdgdrkwldvtnkytndvaakvpqathkdiddaidaavaaapamaam
gayerkavlekvvaelknrfeeiaqtltmesgkpikdargevtrtidtfqvaaeesvriy
gehipldisarnkglqgivkkfpigpvsmvspwnfplnlvahkvapaiavgcpfvlkpas
rtplsalilgeilhkieelplgafsilpvsredadmftvderfklltftgsgpigwdmka
ragkkkvvmelggnapcivddyvpdldytiqrlinggfyqggqscihmqrlyvherlyde
vkegfvaavkklkmgnpfeedtylgpmisesaakgiedwvkeavakggklltggnrkgaf
ieptviedvpieanarkeeifgpvvllykysdfkeavkecnnthyglqsgiftkdlnkaf
yafehmevggvilndspalrvdsqpygglkdsgiqregvkyamddmletkvlvmrnvgtl

SCOPe Domain Coordinates for d5n5sa_:

Click to download the PDB-style file with coordinates for d5n5sa_.
(The format of our PDB-style files is described here.)

Timeline for d5n5sa_: