Lineage for d1cfzb_ (1cfz B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72308Superfamily c.56.1: HybD-like [53163] (2 families) (S)
  5. 72309Family c.56.1.1: Hydrogenase maturating endopeptidase HybD [53164] (1 protein)
  6. 72310Protein Hydrogenase maturating endopeptidase HybD [53165] (1 species)
  7. 72311Species Escherichia coli [TaxId:562] [53166] (1 PDB entry)
  8. 72313Domain d1cfzb_: 1cfz B: [33755]

Details for d1cfzb_

PDB Entry: 1cfz (more details), 2.2 Å

PDB Description: hydrogenase maturating endopeptidase hybd from e. coli

SCOP Domain Sequences for d1cfzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfzb_ c.56.1.1 (B:) Hydrogenase maturating endopeptidase HybD {Escherichia coli}
mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii
adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi
peslephigltptveamiepaleqvlaalresgveaiprsds

SCOP Domain Coordinates for d1cfzb_:

Click to download the PDB-style file with coordinates for d1cfzb_.
(The format of our PDB-style files is described here.)

Timeline for d1cfzb_: