![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.1: HybD-like [53163] (2 families) ![]() the HybD fold coincides with the consensus core structure |
![]() | Family c.56.1.1: Hydrogenase maturating endopeptidase HybD [53164] (1 protein) automatically mapped to Pfam PF01750 |
![]() | Protein Hydrogenase maturating endopeptidase HybD [53165] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53166] (2 PDB entries) |
![]() | Domain d1cfzb_: 1cfz B: [33755] complexed with cd |
PDB Entry: 1cfz (more details), 2.2 Å
SCOPe Domain Sequences for d1cfzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfzb_ c.56.1.1 (B:) Hydrogenase maturating endopeptidase HybD {Escherichia coli [TaxId: 562]} mrilvlgvgnilltdeaigvrivealeqryilpdyveildggtagmellgdmanrdhlii adaivskknapgtmmilrdeevpalftnkisphqlgladvlsalrftgefpkkltlvgvi peslephigltptveamiepaleqvlaalresgveaiprsds
Timeline for d1cfzb_: