Lineage for d5l21a2 (5l21 A:1093-1296)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385683Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2385726Protein automated matches [229100] (6 species)
    not a true protein
  7. 2385746Species Clostridium botulinum [TaxId:441771] [337544] (1 PDB entry)
  8. 2385747Domain d5l21a2: 5l21 A:1093-1296 [337545]
    Other proteins in same PDB: d5l21a1, d5l21a3, d5l21b_
    automated match to d3btaa2

Details for d5l21a2

PDB Entry: 5l21 (more details), 1.68 Å

PDB Description: crystal structure of bont/a receptor binding domain in complex with vhh c2
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5l21a2:

Sequence, based on SEQRES records: (download)

>d5l21a2 b.42.4.2 (A:1093-1296) automated matches {Clostridium botulinum [TaxId: 441771]}
nsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylns
slyrgakfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleip
dvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqie
rssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records): (download)

>d5l21a2 b.42.4.2 (A:1093-1296) automated matches {Clostridium botulinum [TaxId: 441771]}
nsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylns
slyrgakfiikkynkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipdvg
nlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnwynrqierss
rtlgcswefipvddgwgerpl

SCOPe Domain Coordinates for d5l21a2:

Click to download the PDB-style file with coordinates for d5l21a2.
(The format of our PDB-style files is described here.)

Timeline for d5l21a2:

View in 3D
Domains from other chains:
(mouse over for more information)
d5l21b_