SCOPe 2.07: Domain d5l21a1: 5l21 A:872-1092

Lineage for d5l21a1 (5l21 A:872-1092)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein automated matches [229097] (6 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:441771] [337542] (1 PDB entry)

8. Domain d5l21a1: 5l21 A:872-1092 [337543]
   Other proteins in same PDB: d5l21a2, d5l21a3, d5l21b_
   automated match to d3btaa1

Details for d5l21a1

PDB Entry: 5l21, 1.68 Å

PDB Description: crystal structure of bont/a receptor binding domain in complex with vhh c2

PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5l21a1:

Sequence; same for both SEQRES and ATOM records:

>d5l21a1 b.29.1.6 (A:872-1092) automated matches {Clostridium botulinum [TaxId: 441771]}
niintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilkna
ivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtq
eikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasn
nimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqs

Timeline for d5l21a1:

• d5l21a1 first appeared in SCOPe 2.06
  
• d5l21a1 appears in the current release, SCOPe 2.08