Lineage for d5l21a1 (5l21 A:872-1092)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779820Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. 2779869Protein automated matches [229097] (6 species)
    not a true protein
  7. 2779891Species Clostridium botulinum [TaxId:441771] [337542] (1 PDB entry)
  8. 2779892Domain d5l21a1: 5l21 A:872-1092 [337543]
    Other proteins in same PDB: d5l21a2, d5l21a3, d5l21b_
    automated match to d3btaa1

Details for d5l21a1

PDB Entry: 5l21 (more details), 1.68 Å

PDB Description: crystal structure of bont/a receptor binding domain in complex with vhh c2
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5l21a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l21a1 b.29.1.6 (A:872-1092) automated matches {Clostridium botulinum [TaxId: 441771]}
niintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilkna
ivynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtq
eikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasn
nimfkldgcrdthryiwikyfnlfdkelnekeikdlydnqs

SCOPe Domain Coordinates for d5l21a1:

Click to download the PDB-style file with coordinates for d5l21a1.
(The format of our PDB-style files is described here.)

Timeline for d5l21a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d5l21b_