Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein automated matches [191167] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189384] (17 PDB entries) |
Domain d5kyfb_: 5kyf B: [337538] Other proteins in same PDB: d5kyfc_ automated match to d1nbfa_ complexed with gol; mutant |
PDB Entry: 5kyf (more details), 1.45 Å
SCOPe Domain Sequences for d5kyfb_:
Sequence, based on SEQRES records: (download)
>d5kyfb_ d.3.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel qhsdkpvgtkkltksfgwetldsfmqhdvqeacrvlldnvenkmkgtcvegtipklfrgk mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrie
>d5kyfb_ d.3.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel qhsdkpvgtkkltksfgwetldsfmqhdvqeacrvlldnvenkmkgtcvegtipklfrgk mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdvrhct naymlvyiresklsevlqavtdhdipqqlverlqeekrie
Timeline for d5kyfb_: