SCOPe 2.06: Domain d5kgga_: 5kgg A:

Lineage for d5kgga_ (5kgg A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (99 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d5kgga_: 5kgg A: [337535]
   automated match to d4n70a_
   complexed with 6so, cl, edo, so4

Details for d5kgga_

PDB Entry: 5kgg, 1.95 Å

PDB Description: crystal structure of pim1 with inhibitor: 2-(5-chloranyl-1~{h}-indol- 3-yl)ethanamine

PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d5kgga_:

Sequence; same for both SEQRES and ATOM records:

>d5kgga_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d5kgga_:

• d5kgga_ is new in SCOPe 2.06-stable
  
• d5kgga_ appears in SCOPe 2.07
  
• d5kgga_ appears in the current release, SCOPe 2.08