Lineage for d5gxob2 (5gxo B:108-221)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2552895Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2553021Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2553085Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)
  8. 2553155Domain d5gxob2: 5gxo B:108-221 [337534]
    Other proteins in same PDB: d5gxoa1, d5gxob1
    automated match to d1luva2
    complexed with mn

Details for d5gxob2

PDB Entry: 5gxo (more details), 2.3 Å

PDB Description: discovery of a compound that activates sirt3 to deacetylate manganese superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5gxob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxob2 d.44.1.1 (B:108-221) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymack

SCOPe Domain Coordinates for d5gxob2:

Click to download the PDB-style file with coordinates for d5gxob2.
(The format of our PDB-style files is described here.)

Timeline for d5gxob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gxob1