| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
| Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries) |
| Domain d5gxob2: 5gxo B:108-221 [337534] Other proteins in same PDB: d5gxoa1, d5gxob1 automated match to d1luva2 complexed with mn |
PDB Entry: 5gxo (more details), 2.3 Å
SCOPe Domain Sequences for d5gxob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gxob2 d.44.1.1 (B:108-221) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymack
Timeline for d5gxob2: