SCOPe 2.07: Domain d5kycb_: 5kyc B:

Lineage for d5kycb_ (5kyc B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
   Pfam PF00443

6. Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82570] (25 PDB entries)

8. Domain d5kycb_: 5kyc B: [337532]
   Other proteins in same PDB: d5kycc_
   automated match to d1nbfa_
   complexed with gol, mla; mutant

Details for d5kycb_

PDB Entry: 5kyc, 1.43 Å

PDB Description: crystal structure of usp7 catalytic domain [v302k] mutant in complex with ubiquitin (malonate bound)

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d5kycb_:

Sequence; same for both SEQRES and ATOM records:

>d5kycb_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
htgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelqh
sdkpvgtkkltksfgwetldsfmqhdvqelcrklldnvenkmkgtcvegtipklfrgkmv
syiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqea
ekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpanyi
lhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsvrh
ctnaymlvyiresklsevlqavtdhdipqqlverlqeekr

Timeline for d5kycb_:

• d5kycb_ first appeared in SCOPe 2.06
  
• d5kycb_ appears in the current release, SCOPe 2.08