Lineage for d5kycb_ (5kyc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927329Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2927360Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)
  7. 2927361Species Human (Homo sapiens) [TaxId:9606] [82570] (25 PDB entries)
  8. 2927362Domain d5kycb_: 5kyc B: [337532]
    Other proteins in same PDB: d5kycc_
    automated match to d1nbfa_
    complexed with gol, mla; mutant

Details for d5kycb_

PDB Entry: 5kyc (more details), 1.43 Å

PDB Description: crystal structure of usp7 catalytic domain [v302k] mutant in complex with ubiquitin (malonate bound)
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d5kycb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kycb_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
htgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelqh
sdkpvgtkkltksfgwetldsfmqhdvqelcrklldnvenkmkgtcvegtipklfrgkmv
syiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqea
ekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpanyi
lhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsvrh
ctnaymlvyiresklsevlqavtdhdipqqlverlqeekr

SCOPe Domain Coordinates for d5kycb_:

Click to download the PDB-style file with coordinates for d5kycb_.
(The format of our PDB-style files is described here.)

Timeline for d5kycb_: