Lineage for d5mz5d_ (5mz5 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2157920Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2157921Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2158358Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2158359Protein automated matches [190683] (49 species)
    not a true protein
  7. 2158760Species Physcomitrella patens [TaxId:3218] [337517] (3 PDB entries)
  8. 2158764Domain d5mz5d_: 5mz5 D: [337528]
    automated match to d1wnda_
    complexed with edo, gol, peg

Details for d5mz5d_

PDB Entry: 5mz5 (more details), 2.15 Å

PDB Description: crystal structure of aldehyde dehydrogenase 21 (aldh21) from physcomitrella patens in its apoform
PDB Compounds: (D:) aldh21)

SCOPe Domain Sequences for d5mz5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mz5d_ c.82.1.0 (D:) automated matches {Physcomitrella patens [TaxId: 3218]}
tpkkyniflaskpvdgdrkwldvtnkytndvaakvpqathkdiddaidaavaaapamaam
gayerkavlekvvaelknrfeeiaqtltmesgkpikdargevtrtidtfqvaaeesvriy
gehipldisarnkglqgivkkfpigpvsmvspwnfplnlvahkvapaiavgcpfvlkpas
rtplsalilgeilhkieelplgafsilpvsredadmftvderfklltftgsgpigwdmka
ragkkkvvmelggnapcivddyvpdldytiqrlinggfyqggqscihmqrlyvherlyde
vkegfvaavkklkmgnpfeedtylgpmisesaakgiedwvkeavakggklltggnrkgaf
ieptviedvpieanarkeeifgpvvllykysdfkeavkecnnthyglqsgiftkdlnkaf
yafehmevggvilndspalrvdsqpygglkdsgiqregvkyamddmletkvlvmrnvgtl

SCOPe Domain Coordinates for d5mz5d_:

Click to download the PDB-style file with coordinates for d5mz5d_.
(The format of our PDB-style files is described here.)

Timeline for d5mz5d_: