SCOP 1.73: Domain d1eh8a2: 1eh8 A:5-91

Lineage for d1eh8a2 (1eh8 A:5-91)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family)

5. Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)

8. Domain d1eh8a2: 1eh8 A:5-91 [33752]
   Other proteins in same PDB: d1eh8a1
   complexed with zn

Details for d1eh8a2

PDB Entry: 1eh8, 2.5 Å

PDB Description: benzylated human o6-alkylguanine-dna alkyltransferase

PDB Compounds: (A:) o6-alkylguanine-DNA alkyltransferase

SCOP Domain Sequences for d1eh8a2:

Sequence, based on SEQRES records:

>d1eh8a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta
wlnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records):

>d1eh8a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgevpapaavlggpeplmqctawlnayfhqp
eaieefpvpalhhpvfqq

Timeline for d1eh8a2:

• d1eh8a2 first appeared (with stable ids) in SCOP 1.55
  
• d1eh8a2 appears in SCOP 1.71
  
• d1eh8a2 appears in SCOP 1.75
  
• d1eh8a2 appears in the current release, SCOPe 2.08