SCOPe 2.08: Domain d5l21b_: 5l21 B:

Lineage for d5l21b_ (5l21 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5l21b_: 5l21 B: [337514]
   Other proteins in same PDB: d5l21a1, d5l21a2, d5l21a3
   automated match to d4bele_

Details for d5l21b_

PDB Entry: 5l21, 1.68 Å

PDB Description: crystal structure of bont/a receptor binding domain in complex with vhh c2

PDB Compounds: (B:) vhh-c2

SCOPe Domain Sequences for d5l21b_:

Sequence; same for both SEQRES and ATOM records:

>d5l21b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglaqpggslrlsceasgfgtwfrfdentvnwyrqppgksrefdelvarypk
sgivtyldsvkgrftisrdnakkmaflqmdnlkpedtavyycnvgefwgqgtqvtisse

Timeline for d5l21b_:

• d5l21b_ first appeared in SCOPe 2.06
  
• d5l21b_ appears in SCOPe 2.07