Lineage for d5l21b_ (5l21 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (22 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
  8. 2348306Domain d5l21b_: 5l21 B: [337514]
    Other proteins in same PDB: d5l21a1, d5l21a2, d5l21a3
    automated match to d4bele_

Details for d5l21b_

PDB Entry: 5l21 (more details), 1.68 Å

PDB Description: crystal structure of bont/a receptor binding domain in complex with vhh c2
PDB Compounds: (B:) vhh-c2

SCOPe Domain Sequences for d5l21b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l21b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglaqpggslrlsceasgfgtwfrfdentvnwyrqppgksrefdelvarypk
sgivtyldsvkgrftisrdnakkmaflqmdnlkpedtavyycnvgefwgqgtqvtisse

SCOPe Domain Coordinates for d5l21b_:

Click to download the PDB-style file with coordinates for d5l21b_.
(The format of our PDB-style files is described here.)

Timeline for d5l21b_: