Lineage for d1eh6a2 (1eh6 A:5-91)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72294Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) (S)
  5. 72295Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)
  6. 72299Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)
  7. 72302Species Human (Homo sapiens) [TaxId:9606] [53160] (4 PDB entries)
  8. 72305Domain d1eh6a2: 1eh6 A:5-91 [33751]
    Other proteins in same PDB: d1eh6a1

Details for d1eh6a2

PDB Entry: 1eh6 (more details), 2 Å

PDB Description: human o6-alkylguanine-dna alkyltransferase

SCOP Domain Sequences for d1eh6a2:

Sequence, based on SEQRES records: (download)

>d1eh6a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta
wlnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records): (download)

>d1eh6a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
cemkrttldsplgklelsgceqglheikllgevpapaavlggpeplmqctawlnayfhqp
eaieefpvpalhhpvfqq

SCOP Domain Coordinates for d1eh6a2:

Click to download the PDB-style file with coordinates for d1eh6a2.
(The format of our PDB-style files is described here.)

Timeline for d1eh6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eh6a1