Lineage for d5jbka_ (5jbk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2419554Species Trichoderma harzianum [TaxId:5544] [319250] (3 PDB entries)
  8. 2419556Domain d5jbka_: 5jbk A: [337509]
    automated match to d2xhya_
    complexed with gol

Details for d5jbka_

PDB Entry: 5jbk (more details), 2.59 Å

PDB Description: trichoderma harzianum gh1 beta-glucosidase thbgl1
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d5jbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jbka_ c.1.8.0 (A:) automated matches {Trichoderma harzianum [TaxId: 5544]}
mmlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtae
diallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfh
wdlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfneplcsaipgygsgtf
apgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldr
eaaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhyts
nyirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskryny
pkiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslm
dnfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak

SCOPe Domain Coordinates for d5jbka_:

Click to download the PDB-style file with coordinates for d5jbka_.
(The format of our PDB-style files is described here.)

Timeline for d5jbka_: