Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [330659] (3 PDB entries) |
Domain d5iomb1: 5iom B:2-149 [337505] Other proteins in same PDB: d5ioma2, d5iomb2 automated match to d5bxib_ |
PDB Entry: 5iom (more details), 1.9 Å
SCOPe Domain Sequences for d5iomb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iomb1 d.58.6.1 (B:2-149) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} ertfimvkpdgvqrglvgeviqrferrgyklvaikmmhaseqllqthyealkslsffpkl vaymssgpvvpmvfegrkvvengrtmlgatkpeascpgsirgdycqdvgrnvvhgsdste sanreinlwfspqelcqykqavdpwihe
Timeline for d5iomb1: