Lineage for d5iomb1 (5iom B:2-149)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194613Protein automated matches [190032] (18 species)
    not a true protein
  7. 2194802Species Schistosoma mansoni [TaxId:6183] [330659] (3 PDB entries)
  8. 2194816Domain d5iomb1: 5iom B:2-149 [337505]
    Other proteins in same PDB: d5ioma2, d5iomb2
    automated match to d5bxib_

Details for d5iomb1

PDB Entry: 5iom (more details), 1.9 Å

PDB Description: crystal structure of nucleoside diphosphate kinase from schistosoma mansoni is space group p6322
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5iomb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iomb1 d.58.6.1 (B:2-149) automated matches {Schistosoma mansoni [TaxId: 6183]}
ertfimvkpdgvqrglvgeviqrferrgyklvaikmmhaseqllqthyealkslsffpkl
vaymssgpvvpmvfegrkvvengrtmlgatkpeascpgsirgdycqdvgrnvvhgsdste
sanreinlwfspqelcqykqavdpwihe

SCOPe Domain Coordinates for d5iomb1:

Click to download the PDB-style file with coordinates for d5iomb1.
(The format of our PDB-style files is described here.)

Timeline for d5iomb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5iomb2