SCOP 1.55: Domain d1eh7a2: 1eh7 A:5-91

Lineage for d1eh7a2 (1eh7 A:5-91)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family)

5. Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53160] (4 PDB entries)

8. Domain d1eh7a2: 1eh7 A:5-91 [33750]
   Other proteins in same PDB: d1eh7a1

Details for d1eh7a2

PDB Entry: 1eh7, 2 Å

PDB Description: methylated human o6-alkylguanine-dna alkyltransferase

SCOP Domain Sequences for d1eh7a2:

Sequence, based on SEQRES records:

>d1eh7a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta
wlnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records):

>d1eh7a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
cemkrttldsplgklelsgceqglheikllgvpapaavlggpeplmqctawlnayfhqpe
aieefpvpalhhpvfqq

Timeline for d1eh7a2:

• d1eh7a2 appears in SCOP 1.57
  
• d1eh7a2 appears in the current release, SCOPe 2.08