Lineage for d1eh7a2 (1eh7 A:5-91)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887784Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) (S)
  5. 2887785Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)
  6. 2887789Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)
  7. 2887790Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)
    Uniprot P16455 6-176
  8. 2887792Domain d1eh7a2: 1eh7 A:5-91 [33750]
    Other proteins in same PDB: d1eh7a1
    complexed with zn

Details for d1eh7a2

PDB Entry: 1eh7 (more details), 2 Å

PDB Description: methylated human o6-alkylguanine-dna alkyltransferase
PDB Compounds: (A:) o6-alkylguanine-DNA alkyltransferase

SCOPe Domain Sequences for d1eh7a2:

Sequence, based on SEQRES records: (download)

>d1eh7a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta
wlnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records): (download)

>d1eh7a2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgvpapaavlggpeplmqctawlnayfhqpe
aieefpvpalhhpvfqq

SCOPe Domain Coordinates for d1eh7a2:

Click to download the PDB-style file with coordinates for d1eh7a2.
(The format of our PDB-style files is described here.)

Timeline for d1eh7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eh7a1