SCOPe 2.06: Domain d5kyda_: 5kyd A:

Lineage for d5kyda_ (5kyd A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
   Pfam PF00443

6. Protein automated matches [191167] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189384] (17 PDB entries)

8. Domain d5kyda_: 5kyd A: [337497]
   Other proteins in same PDB: d5kydd_
   automated match to d1nbfa_
   mutant

Details for d5kyda_

PDB Entry: 5kyd, 1.62 Å

PDB Description: crystal structure of usp7 catalytic domain [v302k] mutant in complex with ubiquitin

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d5kyda_:

Sequence; same for both SEQRES and ATOM records:

>d5kyda_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
htgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyelqh
sdkpvgtkkltksfgwetldsfmqhdvqelcrklldnvenkmkgtcvegtipklfrgkmv
syiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglqea
ekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpanyi
lhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsvrh
ctnaymlvyiresklsevlqavtdhdipqqlverlqeekri

Timeline for d5kyda_:

• d5kyda_ is new in SCOPe 2.06-stable
  
• d5kyda_ appears in SCOPe 2.07
  
• d5kyda_ appears in the current release, SCOPe 2.08