Lineage for d5kpua_ (5kpu A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. Protein beta-Lactamase, class A [56606] (16 species)
  7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries)
  8. Domain d5kpua_: 5kpu A: [337495]
    automated match to d1erma_
    complexed with xe; mutant

Details for d5kpua_

PDB Entry: 5kpu (more details), 1.5 Å

PDB Description: crystal structure of tem1 beta-lactamase mutant i263l in the presence of 1.2 mpa xenon
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d5kpua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kpua_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivvlyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d5kpua_ are not available.

Timeline for d5kpua_:

Domains from other chains:
(mouse over for more information)
d5kpub_, d5kpuc_, d5kpud_