![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
![]() | Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (2 species) has different dimerisation mode |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54133] (19 PDB entries) Uniprot P13501 25-91 |
![]() | Domain d5l2uh_: 5l2u H: [337494] automated match to d1u4lb_ complexed with cl, epe, gol |
PDB Entry: 5l2u (more details), 2.28 Å
SCOPe Domain Sequences for d5l2uh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l2uh_ d.9.1.1 (H:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]} sdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyins lems
Timeline for d5l2uh_: