SCOPe 2.08: Domain d5gqdb1: 5gqd B:501-803

Lineage for d5gqdb1 (5gqd B:501-803)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (28 species)
   not a true protein

7. Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)

8. Domain d5gqdb1: 5gqd B:501-803 [337492]
   Other proteins in same PDB: d5gqda2, d5gqdb2
   automated match to d2d1za1
   complexed with gol; mutant

Details for d5gqdb1

PDB Entry: 5gqd, 1.8 Å

PDB Description: crystal structure of covalent glycosyl-enzyme intermediate of xylanase mutant (t82a, n127s, and e128h) from streptomyces olivaceoviridis e- 86

PDB Compounds: (B:) Beta-xylanase

SCOPe Domain Sequences for d5gqdb1:

Sequence; same for both SEQRES and ATOM records:

>d5gqdb1 c.1.8.3 (B:501-803) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghalawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

Timeline for d5gqdb1:

• d5gqdb1 first appeared in SCOPe 2.06
  
• d5gqdb1 appears in SCOPe 2.07