Lineage for d5gqdb1 (5gqd B:501-803)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831332Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)
  8. 2831339Domain d5gqdb1: 5gqd B:501-803 [337492]
    Other proteins in same PDB: d5gqda2, d5gqdb2
    automated match to d2d1za1
    complexed with gol; mutant

Details for d5gqdb1

PDB Entry: 5gqd (more details), 1.8 Å

PDB Description: crystal structure of covalent glycosyl-enzyme intermediate of xylanase mutant (t82a, n127s, and e128h) from streptomyces olivaceoviridis e- 86
PDB Compounds: (B:) Beta-xylanase

SCOPe Domain Sequences for d5gqdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gqdb1 c.1.8.3 (B:501-803) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghalawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOPe Domain Coordinates for d5gqdb1:

Click to download the PDB-style file with coordinates for d5gqdb1.
(The format of our PDB-style files is described here.)

Timeline for d5gqdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gqdb2