Lineage for d1qnta2 (1qnt A:6-91)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2125360Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) (S)
  5. 2125361Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 protein domains)
  6. 2125365Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)
  7. 2125366Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)
    Uniprot P16455 6-176
  8. 2125367Domain d1qnta2: 1qnt A:6-91 [33749]
    Other proteins in same PDB: d1qnta1

Details for d1qnta2

PDB Entry: 1qnt (more details), 1.9 Å

PDB Description: x-ray structure of human o6alkylguanine-dna alkyltransferase
PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1qnta2:

Sequence, based on SEQRES records: (download)

>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqctaw
lnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records): (download)

>d1qnta2 c.55.7.1 (A:6-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
emkrttldsplgklelsgceqglheikllgkdavevpapaavlggpeplmqctawlnayf
hqpeaieefpvpalhhpvfqq

SCOPe Domain Coordinates for d1qnta2:

Click to download the PDB-style file with coordinates for d1qnta2.
(The format of our PDB-style files is described here.)

Timeline for d1qnta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qnta1