Lineage for d5jn0a_ (5jn0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965668Protein automated matches [190202] (2 species)
    not a true protein
  7. 2965669Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)
  8. 2965677Domain d5jn0a_: 5jn0 A: [337481]
    automated match to d1ju5a_
    complexed with cl

Details for d5jn0a_

PDB Entry: 5jn0 (more details), 1.68 Å

PDB Description: crk-ii sh2 domain
PDB Compounds: (A:) CRK-II SH2 domain

SCOPe Domain Sequences for d5jn0a_:

Sequence, based on SEQRES records: (download)

>d5jn0a_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dseersswywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinss
gprrlrigdqefdslpallefykihyldtttliepvars

Sequence, based on observed residues (ATOM records): (download)

>d5jn0a_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dseersswywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinsr
rlrigdqefdslpallefykihyldtttliepvars

SCOPe Domain Coordinates for d5jn0a_:

Click to download the PDB-style file with coordinates for d5jn0a_.
(The format of our PDB-style files is described here.)

Timeline for d5jn0a_: