Lineage for d5h71a_ (5h71 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913623Protein Alginate-binding periplasmic protein AlgQ2 [69624] (1 species)
  7. 2913624Species Sphingomonas sp. [TaxId:28214] [69625] (5 PDB entries)
  8. 2913625Domain d5h71a_: 5h71 A: [337480]
    automated match to d1j1na_
    complexed with ca, cl, peg

    has additional insertions and/or extensions that are not grouped together

Details for d5h71a_

PDB Entry: 5h71 (more details), 1.55 Å

PDB Description: structure of alginate-binding protein algq2 in complex with an alginate trisaccharide
PDB Compounds: (A:) AlgQ2

SCOPe Domain Sequences for d5h71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h71a_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]}
eatwvtdkpltlkihmhfrdkwvwdenwpvakesfrltnvklqsvankaatnsqeqfnlm
masgdlpdvvggdnlkdkfiqygqegafvplnklidqyaphikaffkshpeveraikapd
gniyfipyvpdgvvargyfiredwlkklnlkppqnidelytvlkafkekdpngngkadev
pfidrhpdevfrlvnfwgarssgsdnymdfyidngrvkhpwaetafrdgmkhvaqwykeg
lidkeiftrkakareqmfggnlggfthdwfastmtfneglaktvpgfklipiapptnskg
qrweedsrqkvrpdgwaitvknknpvetikffdfyfsrpgrdisnfgvpgvtydikngka
vfkdsvlkspqpvnnqlydmgaqipigfwqdydyerqwttpeaqagidmyvkgkyvmpgf
egvnmtreeraiydkywadvrtymyemgqawvmgtkdvdktwdeyqrqlklrglyqvlqm
mqqaydrqy

SCOPe Domain Coordinates for d5h71a_:

Click to download the PDB-style file with coordinates for d5h71a_.
(The format of our PDB-style files is described here.)

Timeline for d5h71a_: