SCOPe 2.08: Domain d5h71a_: 5h71 A:

Lineage for d5h71a_ (5h71 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Alginate-binding periplasmic protein AlgQ2 [69624] (1 species)

7. Species Sphingomonas sp. [TaxId:28214] [69625] (5 PDB entries)

8. Domain d5h71a_: 5h71 A: [337480]
   automated match to d1j1na_
   complexed with ca, cl, peg
   has additional insertions and/or extensions that are not grouped together

Details for d5h71a_

PDB Entry: 5h71, 1.55 Å

PDB Description: structure of alginate-binding protein algq2 in complex with an alginate trisaccharide

PDB Compounds: (A:) AlgQ2

SCOPe Domain Sequences for d5h71a_:

Sequence; same for both SEQRES and ATOM records:

>d5h71a_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]}
eatwvtdkpltlkihmhfrdkwvwdenwpvakesfrltnvklqsvankaatnsqeqfnlm
masgdlpdvvggdnlkdkfiqygqegafvplnklidqyaphikaffkshpeveraikapd
gniyfipyvpdgvvargyfiredwlkklnlkppqnidelytvlkafkekdpngngkadev
pfidrhpdevfrlvnfwgarssgsdnymdfyidngrvkhpwaetafrdgmkhvaqwykeg
lidkeiftrkakareqmfggnlggfthdwfastmtfneglaktvpgfklipiapptnskg
qrweedsrqkvrpdgwaitvknknpvetikffdfyfsrpgrdisnfgvpgvtydikngka
vfkdsvlkspqpvnnqlydmgaqipigfwqdydyerqwttpeaqagidmyvkgkyvmpgf
egvnmtreeraiydkywadvrtymyemgqawvmgtkdvdktwdeyqrqlklrglyqvlqm
mqqaydrqy

Timeline for d5h71a_:

• d5h71a_ first appeared in SCOPe 2.06
  
• d5h71a_ appears in SCOPe 2.07