Lineage for d1sfe_2 (1sfe 12-92)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25467Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) (S)
  5. 25468Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)
  6. 25469Protein Ada DNA repair protein [53157] (1 species)
  7. 25470Species Escherichia coli [TaxId:562] [53158] (1 PDB entry)
  8. 25471Domain d1sfe_2: 1sfe 12-92 [33748]
    Other proteins in same PDB: d1sfe_1

Details for d1sfe_2

PDB Entry: 1sfe (more details), 2.1 Å

PDB Description: ada o6-methylguanine-dna methyltransferase from escherichia coli

SCOP Domain Sequences for d1sfe_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfe_2 c.55.7.1 (12-92) Ada DNA repair protein {Escherichia coli}
lavryaladcelgrclvaesergicaillgdddatliselqqmfpaadnapadlmfqqhv
reviaslnqrdtpltlpldir

SCOP Domain Coordinates for d1sfe_2:

Click to download the PDB-style file with coordinates for d1sfe_2.
(The format of our PDB-style files is described here.)

Timeline for d1sfe_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sfe_1