Lineage for d1sfea2 (1sfe A:12-92)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2464538Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) (S)
  5. 2464539Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 protein domains)
  6. 2464540Protein Ada DNA repair protein [53157] (1 species)
  7. 2464541Species Escherichia coli [TaxId:562] [53158] (1 PDB entry)
  8. 2464542Domain d1sfea2: 1sfe A:12-92 [33748]
    Other proteins in same PDB: d1sfea1

Details for d1sfea2

PDB Entry: 1sfe (more details), 2.1 Å

PDB Description: ada o6-methylguanine-dna methyltransferase from escherichia coli
PDB Compounds: (A:) ada o6-methylguanine-DNA methyltransferase

SCOPe Domain Sequences for d1sfea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfea2 c.55.7.1 (A:12-92) Ada DNA repair protein {Escherichia coli [TaxId: 562]}
lavryaladcelgrclvaesergicaillgdddatliselqqmfpaadnapadlmfqqhv
reviaslnqrdtpltlpldir

SCOPe Domain Coordinates for d1sfea2:

Click to download the PDB-style file with coordinates for d1sfea2.
(The format of our PDB-style files is described here.)

Timeline for d1sfea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sfea1