SCOPe 2.08: Domain d1sfea2: 1sfe A:12-92

Lineage for d1sfea2 (1sfe A:12-92)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families)

5. Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)

6. Protein Ada DNA repair protein [53157] (1 species)

7. Species Escherichia coli [TaxId:562] [53158] (1 PDB entry)

8. Domain d1sfea2: 1sfe A:12-92 [33748]
   Other proteins in same PDB: d1sfea1
   has additional insertions and/or extensions that are not grouped together

Details for d1sfea2

PDB Entry: 1sfe, 2.1 Å

PDB Description: ada o6-methylguanine-dna methyltransferase from escherichia coli

PDB Compounds: (A:) ada o6-methylguanine-DNA methyltransferase

SCOPe Domain Sequences for d1sfea2:

Sequence; same for both SEQRES and ATOM records:

>d1sfea2 c.55.7.1 (A:12-92) Ada DNA repair protein {Escherichia coli [TaxId: 562]}
lavryaladcelgrclvaesergicaillgdddatliselqqmfpaadnapadlmfqqhv
reviaslnqrdtpltlpldir

Timeline for d1sfea2:

• d1sfea2 first appeared (with stable ids) in SCOP 1.55, called d1sfe_2
  
• d1sfea2 appears in SCOPe 2.07