Lineage for d5gqeb1 (5gqe B:501-803)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831332Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries)
  8. 2831347Domain d5gqeb1: 5gqe B:501-803 [337478]
    Other proteins in same PDB: d5gqea2, d5gqeb2
    automated match to d2d1za1
    mutant

Details for d5gqeb1

PDB Entry: 5gqe (more details), 2.5 Å

PDB Description: crystal structure of michaelis complex of xylanase mutant (t82a, n127s, and e128h) from streptomyces olivaceoviridis e-86
PDB Compounds: (B:) Beta-xylanase

SCOPe Domain Sequences for d5gqeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gqeb1 c.1.8.3 (B:501-803) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghalawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOPe Domain Coordinates for d5gqeb1:

Click to download the PDB-style file with coordinates for d5gqeb1.
(The format of our PDB-style files is described here.)

Timeline for d5gqeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gqeb2