Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (28 species) not a true protein |
Species Streptomyces olivaceoviridis [TaxId:1921] [225150] (10 PDB entries) |
Domain d5gqeb1: 5gqe B:501-803 [337478] Other proteins in same PDB: d5gqea2, d5gqeb2 automated match to d2d1za1 mutant |
PDB Entry: 5gqe (more details), 2.5 Å
SCOPe Domain Sequences for d5gqeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gqeb1 c.1.8.3 (B:501-803) automated matches {Streptomyces olivaceoviridis [TaxId: 1921]} aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn fsagdrvynwavqngkqvrghalawhsqqpgwmqslsgstlrqamidhingvmghykgki aqwdvvshafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal ngg
Timeline for d5gqeb1: