SCOPe 2.08: Domain d5gxoa2: 5gxo A:108-221

Lineage for d5gxoa2 (5gxo A:108-221)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)

8. Domain d5gxoa2: 5gxo A:108-221 [337476]
   Other proteins in same PDB: d5gxoa1, d5gxob1
   automated match to d1luva2
   complexed with mn

Details for d5gxoa2

PDB Entry: 5gxo, 2.3 Å

PDB Description: discovery of a compound that activates sirt3 to deacetylate manganese superoxide dismutase

PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5gxoa2:

Sequence; same for both SEQRES and ATOM records:

>d5gxoa2 d.44.1.1 (A:108-221) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymack

Timeline for d5gxoa2:

• d5gxoa2 first appeared in SCOPe 2.06
  
• d5gxoa2 appears in SCOPe 2.07