Lineage for d5gxoa2 (5gxo A:108-221)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513720Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2513721Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2513722Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2513848Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2513912Species Human (Homo sapiens) [TaxId:9606] [54724] (31 PDB entries)
  8. 2513973Domain d5gxoa2: 5gxo A:108-221 [337476]
    Other proteins in same PDB: d5gxoa1, d5gxob1
    automated match to d1luva2
    complexed with mn

Details for d5gxoa2

PDB Entry: 5gxo (more details), 2.3 Å

PDB Description: discovery of a compound that activates sirt3 to deacetylate manganese superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5gxoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxoa2 d.44.1.1 (A:108-221) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymack

SCOPe Domain Coordinates for d5gxoa2:

Click to download the PDB-style file with coordinates for d5gxoa2.
(The format of our PDB-style files is described here.)

Timeline for d5gxoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gxoa1