Lineage for d5gxoa1 (5gxo A:25-107)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303638Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2303702Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries)
  8. 2303771Domain d5gxoa1: 5gxo A:25-107 [337475]
    Other proteins in same PDB: d5gxoa2, d5gxob2
    automated match to d1luva1
    complexed with mn

Details for d5gxoa1

PDB Entry: 5gxo (more details), 2.3 Å

PDB Description: discovery of a compound that activates sirt3 to deacetylate manganese superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d5gxoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gxoa1 a.2.11.1 (A:25-107) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d5gxoa1:

Click to download the PDB-style file with coordinates for d5gxoa1.
(The format of our PDB-style files is described here.)

Timeline for d5gxoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gxoa2