Lineage for d5mx2u_ (5mx2 u:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716633Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2716660Protein automated matches [191005] (3 species)
    not a true protein
  7. 2716661Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries)
  8. 2716664Domain d5mx2u_: 5mx2 u: [337469]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2v_, d5mx2x_, d5mx2z_
    automated match to d2axtu1
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2u_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5mx2u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2u_ a.60.12.2 (u:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5mx2u_:

Click to download the PDB-style file with coordinates for d5mx2u_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2u_: