Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
Protein automated matches [191004] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries) |
Domain d5mx2o_: 5mx2 O: [337468] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_ automated match to d4il6o_ complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi ep
Timeline for d5mx2o_: