Lineage for d5mx2o_ (5mx2 O:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021998Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 3022031Protein automated matches [191004] (2 species)
    not a true protein
  7. 3022032Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)
  8. 3022035Domain d5mx2o_: 5mx2 O: [337468]
    Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_
    automated match to d4il6o_
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2o_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5mx2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
ep

SCOPe Domain Coordinates for d5mx2o_:

Click to download the PDB-style file with coordinates for d5mx2o_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2o_: