SCOPe 2.08: Domain d5mx2l_: 5mx2 L:

Lineage for d5mx2l_ (5mx2 L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161020] (6 PDB entries)
   Uniprot Q8DIN8 1-37

8. Domain d5mx2l_: 5mx2 L: [337467]
   Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_
   automated match to d2axtl1
   complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2l_

PDB Entry: 5mx2, 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5mx2l_:

Sequence; same for both SEQRES and ATOM records:

>d5mx2l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus elongatus [TaxId: 146786]}
epnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d5mx2l_:

• d5mx2l_ first appeared in SCOPe 2.06
  
• d5mx2l_ appears in SCOPe 2.07