Lineage for d5mx2b_ (5mx2 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028885Protein automated matches [191285] (5 species)
    not a true protein
  7. 3028901Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)
  8. 3028944Domain d5mx2b_: 5mx2 B: [337461]
    Other proteins in same PDB: d5mx2a_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_
    automated match to d4il6b_
    complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd

Details for d5mx2b_

PDB Entry: 5mx2 (more details), 2.2 Å

PDB Description: photosystem ii depleted of the mn4cao5 cluster at 2.55 a resolution
PDB Compounds: (B:) Photosystem II CP47 reaction center protein

SCOPe Domain Sequences for d5mx2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx2b_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttrr

SCOPe Domain Coordinates for d5mx2b_:

Click to download the PDB-style file with coordinates for d5mx2b_.
(The format of our PDB-style files is described here.)

Timeline for d5mx2b_: