SCOPe 2.08: Domain d5xl2b1: 5xl2 B:5-323

Lineage for d5xl2b1 (5xl2 B:5-323)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId:137611] [337392] (1 PDB entry)

8. Domain d5xl2b1: 5xl2 B:5-323 [337448]
   Other proteins in same PDB: d5xl2a2, d5xl2b2, d5xl2c2
   automated match to d1ha0a1
   complexed with nag

Details for d5xl2b1

PDB Entry: 5xl2, 2.3 Å

PDB Description: the structure of hemagglutininfrom a swine-origin h4n6 influenza virus

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5xl2b1:

Sequence; same for both SEQRES and ATOM records:

>d5xl2b1 b.19.1.0 (B:5-323) automated matches {Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId: 137611]}
gnpviclghhavsngtmvktltddqievvtaqelvesqhlpelcpsplrlvdgqtcdivn
galgspgcdhlngaewdvfierptavdtcypfdvpdyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwltksdgnayplqnltkvnngdyarlyiwgvhhpst
dteqtnlyknnpgrvtvstqtsqtsvvpnigsrpwvrglssrisfywtivepgdlivfnt
ignliaprghyklnsqkkstilntavpigscvskchtdkgsisttkpfqnisrisigdcp
kyvkqgslklatgmrnipe

Timeline for d5xl2b1:

• d5xl2b1 first appeared in SCOPe 2.06
  
• d5xl2b1 appears in SCOPe 2.07