Lineage for d5xlda_ (5xld A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776399Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337300] (12 PDB entries)
  8. 2776415Domain d5xlda_: 5xld A: [337442]
    Other proteins in same PDB: d5xldc_, d5xldd_
    automated match to d4uoaa_
    complexed with nag; mutant

Details for d5xlda_

PDB Entry: 5xld (more details), 2.3 Å

PDB Description: the structure of hemagglutinin q226l-g228s mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5xlda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlda_ b.19.1.0 (A:) automated matches {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
gnpvicmghhavangtmvktladdqvevvtaqelvesqnlpelcpsplrlvdgqtcdiin
galgspgcdhlngaewdvfierpnavdtcypfdvpeyqslrsilanngkfefiaeefqwn
tvkqngksgackranvndffnrlnwlvksdgnayplqnltkinngdyarlyiwgvhhpst
dteqtnlyknnpggvtvstktsqtsvvpnigsrplvrglssrvsfywtivepgdlivfnt
ignliaprghyklnnqkkstilntaipigscvskchtdkgslsttkpfqnisriavgdcp
ryvkqgslklatgmrnipe

SCOPe Domain Coordinates for d5xlda_:

Click to download the PDB-style file with coordinates for d5xlda_.
(The format of our PDB-style files is described here.)

Timeline for d5xlda_: