| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5xp1a1: 5xp1 A:0-95 [337435] Other proteins in same PDB: d5xp1a2, d5xp1b2, d5xp1c2, d5xp1d2, d5xp1e2, d5xp1f2, d5xp1g2, d5xp1h2 automated match to d4v1db_ mutant |
PDB Entry: 5xp1 (more details), 2.88 Å
SCOPe Domain Sequences for d5xp1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xp1a1 b.1.1.0 (A:0-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
srfsgsgsgtdytftisslqpediatyycqqyqslp
Timeline for d5xp1a1: