Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) |
Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
Protein DNA repair protein MutS, domain II [53152] (2 species) |
Species Thermus aquaticus [TaxId:271] [53153] (4 PDB entries) |
Domain d1fw6b3: 1fw6 B:1121-1266 [33743] Other proteins in same PDB: d1fw6a1, d1fw6a2, d1fw6a4, d1fw6b1, d1fw6b2, d1fw6b4 protein/DNA complex; complexed with adp, mg, so4 |
PDB Entry: 1fw6 (more details), 2.7 Å
SCOPe Domain Sequences for d1fw6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fw6b3 c.55.6.1 (B:1121-1266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]} llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp frfydpgafmrlpeatlralevfepl
Timeline for d1fw6b3:
View in 3D Domains from other chains: (mouse over for more information) d1fw6a1, d1fw6a2, d1fw6a3, d1fw6a4 |